PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna19115.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 705aa    MW: 78946.5 Da    PI: 8.2605
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna19115.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.66.9e-1963109148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              +g WT+eEd  l+dav+++ g++Wk+Ia+++  gRt+ qc +rwqk+l
  mrna19115.1-v1.0-hybrid  63 KGGWTEEEDRVLADAVEKYNGKNWKRIAECVR-GRTDVQCLHRWQKVL 109
                              688*****************************.************986 PP

2Myb_DNA-binding56.37.2e-18115161148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              +g W++eEd+l++++v++ G++ W+ Ia+ ++ gR +kqc++rw+++l
  mrna19115.1-v1.0-hybrid 115 KGFWSKEEDDLIIELVAKQGNKKWSEIAKSLP-GRIGKQCRERWHNHL 161
                              688*****************************.*************97 PP

3Myb_DNA-binding51.52.4e-16167209145
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                              r +WT eE+++l++ +k +G++ W+ Ia+ ++ gRt++++k++w+
  mrna19115.1-v1.0-hybrid 167 RTAWTNEEEQILIQSHKVYGNK-WAEIAKFLP-GRTENSIKNHWN 209
                              679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.88458109IPR017930Myb domain
SuperFamilySSF466895.53E-1659115IPR009057Homeodomain-like
SMARTSM007171.1E-1562111IPR001005SANT/Myb domain
PfamPF002493.6E-1663109IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-2165122IPR009057Homeodomain-like
CDDcd001673.74E-1466109No hitNo description
PROSITE profilePS5129429.752110165IPR017930Myb domain
SuperFamilySSF466898.07E-31112208IPR009057Homeodomain-like
SMARTSM007171.7E-16114163IPR001005SANT/Myb domain
CDDcd001677.21E-15118161No hitNo description
PfamPF139212.9E-18118176No hitNo description
Gene3DG3DSA:1.10.10.609.6E-27123169IPR009057Homeodomain-like
SMARTSM007175.1E-17166214IPR001005SANT/Myb domain
PROSITE profilePS5129421.065166216IPR017930Myb domain
CDDcd001673.62E-13169209No hitNo description
Gene3DG3DSA:1.10.10.601.5E-22170216IPR009057Homeodomain-like
SuperFamilySSF546373.63E-18591698IPR029069HotDog domain
Gene3DG3DSA:3.10.129.109.2E-21592700IPR029069HotDog domain
PfamPF030616.5E-8613688IPR006683Thioesterase domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 705 aa     Download sequence    Send to blast
MVQVKECDPN MEKGVLLSLS PPVSDSSGDQ YNTALKPASA QVFVLDSCVC ILRMTGPTRR  60
STKGGWTEEE DRVLADAVEK YNGKNWKRIA ECVRGRTDVQ CLHRWQKVLS PDLVKGFWSK  120
EEDDLIIELV AKQGNKKWSE IAKSLPGRIG KQCRERWHNH LNPDIKRTAW TNEEEQILIQ  180
SHKVYGNKWA EIAKFLPGRT ENSIKNHWNC SVKKKLELRS FHLSDMESHK TQVGIRKTGL  240
DQIANFDKNV ETCSINLDLV LGTPKGRESL IKSSDKGTRS WLTKGAGADN MTKTPARNLY  300
YDKSAATFGH KVEQRKELYN NYGRLRDSNC LSDRHSINDC STTPSGDLRG SPYCHEKHQN  360
TIYPMSLLNN GLDAFDYNRK AGNFLKKPDH PVTVERIHES SKGSQVYEKI KDASGATKHS  420
DASNPGCLCY RPLQQEDLNY FLENGDFPST DGYIQTEMFS SVSLCTPPSK KGISVDCNDP  480
DSDALEAGIF YELFNQQLFF LLLSVLTFCL PFDVTEDWWN RATQMRKMAN PSTIETESFA  540
STASISKDLP ENHVKHLLQF LKLSGVSGPL PDHCNTKDFY SYLVLGILKP LNIHRGRVTC  600
LVSVKPAFSN FFGGFHGGAI AAVAEAVAFA TARTVVAEDK ELFLGELSIA YLSSAPKNAE  660
VIADGSVVRS GRNLTVIAQE FKLKETGKLI YTARATFYHT PVSKL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C1e-64632166159MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-64632166159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT8934021e-142KT893402.1 Prunus persica cultivar Xiaobaitao Myb family transcription factor 3R-1 (MYB3R-1) mRNA, complete cds.
GenBankKT8934031e-142KT893403.1 Prunus persica cultivar Jinliuzaohong Myb family transcription factor 3R-1 (MYB3R-1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004308398.10.0PREDICTED: uncharacterized protein LOC101303074
TrEMBLM5XNR51e-172M5XNR5_PRUPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF149761314
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.15e-81Homeodomain-like protein